Skip to main content

Antigen Receptor Classifier

Project description

ARC (Antigen Receptor Classifier)

@authors: Swapnil Mahajan, Austin Crinklaw

Requirements:

  • Linux OS
  • HMMER3
  • NCBI Blast+
  • Python 3+
    • Python packages: Pandas, BioPython
  • Git

How to use:

Installation:

The easiest way to use the software is to download and utilize the Dockerfile.

ARC can also be downloaded through PyPI using the following pip command.

pip install bio-arc

Input

  • A fasta format file with one or more protein sequences.
>1WBZ_A_alpha I H2-Kb
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA
>1WBZ_B_b2m I H2-Kb
MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM

Commands

  • A list of commands can be found via the -h flag
python -m ARC -h
  • Specific commands are explained in a similar manner
python -m ARC <command> -h
  • HMMs come by default but can be updated. If they are missing for some they can be added via the install command
python -m ARC update -archive

Note: Archive is an optional parameter that will create an archive folder with HMMs stored by date. You will find this in the data folder wherever you have installed ARC.

  • Using Fasta file as an input:
python -m ARC classify -i /path/to/input.fasta -o /path/to/output.csv

Output

  • Output file has 4 columns in CSV format.
  • First column named 'ID' is the description provoded in the fasta for each sequence.
  • Second column named 'class' is the assigned molecule class for each sequence.
    • e.g. MHC-I, MHC-II, BCR or TCR.
  • The third column named 'chain_type' is the assigned chain type for each sequence.
    • e.g. alpha, beta, heavy, lambda, kappa, scFv, TscFv or construct.
  • The fourth column named 'calc_mhc_allele' is the MHC allele identified using groove domain similarity to MRO alleles.
ID class chain_type calc_mhc_allele
1WBY_A_alpha I H2-Db MHC-I alpha
1WBY_B_b2m I H2-Db
1HQR_A_alpha II HLA-DRA01:01/DRB501:01 MHC-II alpha HLA-DRA*01:01
1HQR_B_beta II HLA-DRA01:01/DRB501:01 MHC-II beta HLA-DRB5*01:01
2CMR_H_heavy BCR heavy
2CMR_L_light BCR kappa
4RFO_L_light BCR lambda
3UZE_A_heavy BCR scFv
1FYT_D_alpha TCR alpha
1FYT_E_beta TCR beta
3TF7_C_alpha TCR TscFv

How it works:

  • BCR and TCR chains are identified using HMMs. A given protein sequence is searched against HMMs built using BCR and TCR chain sequences from IMGT. HMMER is used to align an input sequence to the HMMs.
  • MHC class I (alpha1-alpha2 domains) and MHC class I alpha and beta chain HMMs are downloaded from Pfam website. An input protein sequence is searched against these HMMs. A HMMER bit score threshold of 250 was used to identify MHC chain sequences. DTU uses 250 as a score cutoff which can exclude MHC like molecules such as Human and Mouse CD1d molecules. -To identify MHC alleles, MRO repository is downloaded every time the script is run. Groove domains (G-domains) are assigned to new MRO allles and stored in a CSV file. If this file does not exist then G-domains are assigned to all the MRO alleles (which may slow down the script).

References:

Several pieces of code, including the IMGT ripping / HMM generation, was sourced from ANARCI.

Dunbar J and Deane CM. ANARCI: Antigen receptor numbering and receptor classification. Bioinformatics (2016)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distributions

No source distribution files available for this release.See tutorial on generating distribution archives.

Built Distribution

bio_arc-0.0.4-py3-none-any.whl (3.3 MB view hashes)

Uploaded Python 3

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page