A comprehensive library for computational molecular biology
Project description
Biotite project
Biotite is your Swiss army knife for bioinformatics. Whether you want to identify homologous sequence regions in a protein family or you would like to find disulfide bonds in a protein structure: Biotite has the right tool for you. This package bundles popular tasks in computational molecular biology into a uniform Python library. It can handle a major part of the typical workflow for sequence and biomolecular structure data:
Searching and fetching data from biological databases
Reading and writing popular sequence/structure file formats
Analyzing and editing sequence/structure data
Visualizing sequence/structure data
Interfacing external applications for further analysis
Biotite internally stores most of the data as NumPy ndarray objects, enabling
fast C-accelerated analysis,
intuitive usability through NumPy-like indexing syntax,
extensibility through direct access of the internal NumPy arrays.
As a result the user can skip writing code for basic functionality (like file parsers) and can focus on what their code makes unique - from small analysis scripts to entire bioinformatics software packages.
If you use Biotite in a scientific publication, please cite:
Installation
Biotite requires the following packages:
numpy
requests
msgpack
networkx
Some functions require some extra packages:
mdtraj - Required for trajetory file I/O operations.
matplotlib - Required for plotting purposes.
Biotite can be installed via Conda…
$ conda install -c conda-forge biotite
… or pip
$ pip install biotite
Usage
Here is a small example that downloads two protein sequences from the NCBI Entrez database and aligns them:
import biotite.sequence.align as align
import biotite.sequence.io.fasta as fasta
import biotite.database.entrez as entrez
# Download FASTA file for the sequences of avidin and streptavidin
file_name = entrez.fetch_single_file(
uids=["CAC34569", "ACL82594"], file_name="sequences.fasta",
db_name="protein", ret_type="fasta"
)
# Parse the downloaded FASTA file
# and create 'ProteinSequence' objects from it
fasta_file = fasta.FastaFile.read(file_name)
avidin_seq, streptavidin_seq = fasta.get_sequences(fasta_file).values()
# Align sequences using the BLOSUM62 matrix with affine gap penalty
matrix = align.SubstitutionMatrix.std_protein_matrix()
alignments = align.align_optimal(
avidin_seq, streptavidin_seq, matrix,
gap_penalty=(-10, -1), terminal_penalty=False
)
print(alignments[0])
MVHATSPLLLLLLLSLALVAPGLSAR------KCSLTGKWDNDLGSNMTIGAVNSKGEFTGTYTTAV-TA
-------------------DPSKESKAQAAVAEAGITGTWYNQLGSTFIVTA-NPDGSLTGTYESAVGNA
TSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFS----ESTTVFTGQCFIDRNGKEV-LKTMWLLRSSVN
ESRYVLTGRYDSTPATDGSGT--ALGWTVAWKNNYRNAHSATTWSGQYV---GGAEARINTQWLLTSGTT
DIGDDWKATRVGINIFTRLRTQKE---------------------
-AANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
More documentation, including a tutorial, an example gallery and the API reference is available at https://www.biotite-python.org/.
Contribution
Interested in improving Biotite? Have a look at the contribution guidelines. Feel free to join or community chat on Discord.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distributions
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file biotite-0.32.0.tar.gz.
File metadata
- Download URL: biotite-0.32.0.tar.gz
- Upload date:
- Size: 31.8 MB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
6dee8dca3d61193c4dda936d16d4c388934b1c1f5c981ebe343bbcf72c7332dc
|
|
| MD5 |
1ebb6e8fe9374f1e327ff0d3ef21e75e
|
|
| BLAKE2b-256 |
63b513e76c76ed045d1006a323ad7bd99e122688ee9930bcc66081311498922a
|
File details
Details for the file biotite-0.32.0-cp310-cp310-win_amd64.whl.
File metadata
- Download URL: biotite-0.32.0-cp310-cp310-win_amd64.whl
- Upload date:
- Size: 30.9 MB
- Tags: CPython 3.10, Windows x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
3df13f309de5cf94b6f2c86afbc74670dc0020f826b42ce5f14115aa0d4feba5
|
|
| MD5 |
92d093bff27b5590267d0be1527ef6a9
|
|
| BLAKE2b-256 |
68859a14bc5d8e4675223757d65025830b11447146a57498021aee5079a5cb27
|
File details
Details for the file biotite-0.32.0-cp310-cp310-manylinux1_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp310-cp310-manylinux1_x86_64.whl
- Upload date:
- Size: 44.3 MB
- Tags: CPython 3.10
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
cc0ef92a7ee2a1e5f36affacb752323adf91e254fed0cbb1e9c48966adbd8b25
|
|
| MD5 |
18e64daee02ddf445fdd23cbead2943c
|
|
| BLAKE2b-256 |
c68fe7805cc2dfff797ab7b28f0ba1f82d34d31213f94037d220b61ac7ef7f74
|
File details
Details for the file biotite-0.32.0-cp310-cp310-macosx_10_9_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp310-cp310-macosx_10_9_x86_64.whl
- Upload date:
- Size: 31.5 MB
- Tags: CPython 3.10, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
f670d5757376138b0b1425f43d0ccc7752b896b4c43013003f45a7d44d9596d4
|
|
| MD5 |
36fa4fff51ba0bab56b137f71d67362b
|
|
| BLAKE2b-256 |
337055526a5fb3a683a1f255ce630a2ebd4d6ad555e3d61bb49c207e870d87b2
|
File details
Details for the file biotite-0.32.0-cp39-cp39-win_amd64.whl.
File metadata
- Download URL: biotite-0.32.0-cp39-cp39-win_amd64.whl
- Upload date:
- Size: 30.9 MB
- Tags: CPython 3.9, Windows x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
8f01b9b24674e609b01ca084cbf06a5989e2fed698b0f134c6c8abfcaf70a86f
|
|
| MD5 |
8afb497edc81bc72af01a833cb5cf7cf
|
|
| BLAKE2b-256 |
7fb4b1c641f689f0188dd5d904b702e16f90dd3c9a39668909c459be37b000b6
|
File details
Details for the file biotite-0.32.0-cp39-cp39-manylinux1_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp39-cp39-manylinux1_x86_64.whl
- Upload date:
- Size: 44.2 MB
- Tags: CPython 3.9
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
806609f8ec9dabd0f0067aa0734e117598cc329975f1a7596ddb159450304bb8
|
|
| MD5 |
cdcac6b95685abe1fb6c8002cf106bca
|
|
| BLAKE2b-256 |
0bb6bf80aed57c386dc2a61033f7bfe0cc0155fbcf7fd2cbacfde8a61029766e
|
File details
Details for the file biotite-0.32.0-cp39-cp39-macosx_10_9_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp39-cp39-macosx_10_9_x86_64.whl
- Upload date:
- Size: 31.5 MB
- Tags: CPython 3.9, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
6fffc7982dd0043047c9a23123e8ceee7c478e35bdedf2481e4150cdf8f1499e
|
|
| MD5 |
c2375fcaad65656d7e88ef9c2933fa8e
|
|
| BLAKE2b-256 |
27cd690f18885402e7ed69bf524fcdd9be03f3e8190f4fc78ade7bd6351db68b
|
File details
Details for the file biotite-0.32.0-cp38-cp38-win_amd64.whl.
File metadata
- Download URL: biotite-0.32.0-cp38-cp38-win_amd64.whl
- Upload date:
- Size: 30.9 MB
- Tags: CPython 3.8, Windows x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
5f982761d7f05dc5874f22067632a10cce638ca4c31a162e3f85a1d2e77e237c
|
|
| MD5 |
bac2cc1fc1508aceff1ca45b2ee32bf7
|
|
| BLAKE2b-256 |
28b395936c7f38015373371f9e112f55471d34426f72858e411e616092a2976e
|
File details
Details for the file biotite-0.32.0-cp38-cp38-manylinux1_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp38-cp38-manylinux1_x86_64.whl
- Upload date:
- Size: 45.9 MB
- Tags: CPython 3.8
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
69fa9901b0c26a4dd49c51d48a5918fcebdc5e95d813160daa9e57aeea2b9c3e
|
|
| MD5 |
6d617806f8c20425e9a6a9e9d0cb4757
|
|
| BLAKE2b-256 |
f45bcea5cd633b13947a2e43ac21a9c6de7441464685807599760f2d1c24ad95
|
File details
Details for the file biotite-0.32.0-cp38-cp38-macosx_10_9_x86_64.whl.
File metadata
- Download URL: biotite-0.32.0-cp38-cp38-macosx_10_9_x86_64.whl
- Upload date:
- Size: 31.6 MB
- Tags: CPython 3.8, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.10.1 pkginfo/1.7.1 requests/2.24.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
2ac329571102d47f86091fb0d8902c795db22e77d806b3bd3a5e8d8133556f43
|
|
| MD5 |
c4b4309e5a2039a5df9a490406c5dcce
|
|
| BLAKE2b-256 |
6a4c5baeb14edbea9973bafb0a7e1d67b45d318981fe4a9da9d4205429d10c93
|